missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CNEP1R1 (aa 86-125) Control Fragment Recombinant Protein

Catalog No. RP108133
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108133 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108133 Supplier Invitrogen™ Supplier No. RP108133
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67480 (PA5-67480. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.

Specifications

Accession Number Q8N9A8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 255919
Name Human CNEP1R1 (aa 86-125) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C16orf69; CNEP1R1; CTD nuclear envelope phosphatase 1 regulatory subunit 1; NEP1R1; NEP1-R1; nuclear envelope phosphatase 1-regulatory subunit 1; nuclear envelope phosphatase-regulatory subunit 1; TMEM188; TMP125; Transmembrane protein 188
Common Name CNEP1R1
Gene Symbol CNEP1R1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less