missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107268

Invitrogen™ Human CLCN4 (aa 1-31) Control Fragment Recombinant Protein

Catalog No. RP107268
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107268 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107268 Supplier Invitrogen™ Supplier No. RP107268
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111570 (PA5-111570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain.

Specifications

Accession Number P51793
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1183
Name Human CLCN4 (aa 1-31) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias chloride channel 4; chloride channel 4-2; chloride channel protein 4; chloride channel, voltage-sensitive 4; chloride transporter ClC-4; chloride voltage-gated channel 4; CLC 4; CLC4; clC-4; Clc4-2; ClC-4 A; CLCN4; Clcn4-2; H(+)/Cl(-) exchange transporter 4; MGC163150; putative chloride channel (similar to Mm Clcn4-2); putative chloride channel 4-2
Common Name CLCN4
Gene Symbol CLCN4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less