missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109626

Invitrogen™ Human CHI3L1 (aa 133-198) Control Fragment Recombinant Protein

Catalog No. RP109626
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109626 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109626 Supplier Invitrogen™ Supplier No. RP109626
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human cartilage glycoprotein 39 (GP-39), also known as YKL-40, is a glycoprotein secreted by articular chondrocytes, synoviocytes and macrophages. Serum and synovial fluid GP-39 levels are elevated in inflammatory diseases and correlate with the degree of joint destruction in rheumatoid arthritis. GP-39 is expressed in articular chondrocytes and synovial cells, as well as in liver, but is undetectable in muscle tissues, lung, pancreas, mononuclear cells and fibroblasts. GP-39 is a candidate autoantigen in rheumatoid arthritis and is important in the capacity of cells to respond to and cope with changes in their environment.

Specifications

Accession Number P36222
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1116
Name Human CHI3L1 (aa 133-198) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 38 kDa heparin-binding glycoprotein; 38 kDa heparin-binding glycoprotein; 39 kDa synovial protein; 39 kDa whey protein; 40 kDa secretory signalling glycoprotein; ASRT7; AW208766; BP40; BP40 precursor; breast regression protein 39; Brp39; BRP39 protein; Cartilage glycoprotein 39; cartilage glycoprotein-39; CGP39; CGP-39; CHI3L1; Chil1; chitinase 3 like 1; Chitinase 3 like protein 1 CGP 39; chitinase 3-like 1; chitinase 3-like 1 (cartilage glycoprotein-39); chitinase 3-like 1 protein; chitinase-3-like protein 1; chitinase-like 1; chitinase-like protein 1; CLP-1; DKFZp686N19119; FLJ38139; GP38K; Gp39; GP-39; hCGP39; HC-gp39; hCGP-39; HCGP-3 P; Mammary gland protein 40; MGP-40; signal processing protein; signal-processing protein; SPC-40; SPS-40; YKL40; YKL-40; YYL-40
Common Name CHI3L1
Gene Symbol CHI3L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less