missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94214

Invitrogen™ Human CDCA8 (aa 11-102) Control Fragment Recombinant Protein

Catalog No. RP94214
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94214 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94214 Supplier Invitrogen™ Supplier No. RP94214
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55808 (PA5-55808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDCA8 is a component of a chromosomal passenger complex (CPC) required for stability of the bipolar mitotic spindle. The chromosomal passenger complex, which includes Survivin, CDCA8, INCENP and Aurora-B, is known to play crucial roles during mitosis and cell division. It was found that CDCA8 interacting with Aurora-B, INCENP and Survivin, increases during G2/M phase and then reduces after exit from M phase. CDCA8 is cell cycle regulated, down-regulated in response to p53/Rb-signaling, and up-regulated in many types of cancerous tissues. In Drosophila cells, inactivation of CDCA8 results in polyploidy, delayed mitosis and abnormal tissue development, indicating its critical role for cell proliferation. Recent studies show that CDCA8 is essential for cell proliferation during early embryonic development, and its early embryonic lethality cannot be rescued by the loss of p53. Its aberrant expression is linked to a poor prognosis for gastric cancer.

Specifications

Accession Number Q53HL2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55143
Name Human CDCA8 (aa 11-102) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4831429J16Rik; AU044747; BOR; Borealin; Cdca8; cell division cycle associated 8; cell division cycle-associated protein 8; D4Ertd421e; Dasra B; DasraB; dasra-B; embryonic stem cell-related; hDasra-B; MESrg; MESRGP; PESCRG3; Pluripotent embryonic stem cell-related gene 3 protein
Common Name CDCA8
Gene Symbol CDCA8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less