missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Cdc26 (aa 1-83) Control Fragment Recombinant Protein

Catalog No. rp100238
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100238 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100238 Supplier Invitrogen™ Supplier No. RP100238
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60623 (PA5-60623. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex/cyclosome (APC/C).

Specifications

Accession Number Q8NHZ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 246184
Name Human Cdc26 (aa 1-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010012C09Rik; ANAPC12; anaphase-promoting complex subunit 12; Anaphase-promoting complex subunit CDC26; APC12; BWK-2; C9orf17; CDC26; CDC26 subunit of anaphase promoting complex; cell division cycle 26; cell division cycle 26 homolog; cell division cycle protein 26 homolog; Protein BWK-2
Common Name CDC26
Gene Symbol CDC26
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less