missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD41 (aa 189-287) Control Fragment Recombinant Protein

Catalog No. RP95248
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95248 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95248 Supplier Invitrogen™ Supplier No. RP95248
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111015 (PA5-111015. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD41 (platelet glycoprotein IIb, ITGA2B) is composed of two subunits -120 kDa a, alpha and 23 kDa b, beta- that interact with CD61 in the presence of calcium to form a functional adhesive protein receptor. CD41 is also involved in blood coagulation by mediating platelet aggregation. Upon blood vessel damage, CD41 binds to a variety of proteins including von Willebrand factor, fibrinogen, fibronectin and vitronectin. CD41 is mainly expressed on megakaryocyte-platelet lineage, but generally belongs to the antigens that are expressed during the early stages of hematopoietic differentiation. Diseases associated with CD41 dysfunction include Glansmann Thrombasthenia, and Platelet type-16 bleeding disorder.

Specifications

Accession Number P08514
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3674
Name Human CD41 (aa 189-287) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2 b; integrin alpha 2 b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2 b; integrin subunit alpha IIb; integrin, alpha 2 B; integrin, alpha 2 b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Common Name CD41
Gene Symbol Itga2b
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less