missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108890

Invitrogen™ Human CD103 (aa 32-163) Control Fragment Recombinant Protein

Catalog No. RP108890
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108890 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108890 Supplier Invitrogen™ Supplier No. RP108890
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140223 (PA5-140223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD103 (ITGAE, Integrin alpha E) is molecule that is expressed on mucosa-associated T lymphocytes and activated cells and on subet of TGF beta -1 cells. In particular, CD103 includes a 150kDa alpha chain and a 120kDa beta chain. CD103 is expressed by 0.5 to 2% of resting lymphocytes in peripheral blood and lymphoid organs. CD103 antibody stains a few bone marrow cells and, rarely, peripheral blood lymphocytes. CD103 is part of the integrin family which are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. ITGAE encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, CD103 protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. CD103 is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. Diseases associated with CD103 dysfunction include hairy cell leukemia and splenic marginal zone lymphoma.

Specifications

Accession Number P38570
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3682
Name Human CD103 (aa 32-163) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A530055J10; alpha-E1; alpha-M290; aM290; antigen CD103; antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide; CD103; DC; DCs; HML-1 antigen; human mucosal lymphocyte antigen 1, alpha polypeptide; HUMINAE; integrin alpha E; integrin alpha E, epithelial-associated; integrin alpha E1, epithelial-associated; integrin alpha M290; Integrin alpha-E; Integrin alpha-E heavy chain; Integrin alpha-E light chain; Integrin alpha-IEL; integrin subunit alpha E; integrin, alpha E; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin, alpha E, epithelial-associated; Intregrin alpha E2; Itgae; MGC141996; Mucosal lymphocyte 1 antigen
Common Name CD103 (Integrin alpha E)
Gene Symbol Itgae
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less