missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99842

Invitrogen™ Human CCDC19 (aa 34-116) Control Fragment Recombinant Protein

Catalog No. RP99842
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99842 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99842 Supplier Invitrogen™ Supplier No. RP99842
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59913 (PA5-59913. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

Accession Number Q9UL16
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25790
Name Human CCDC19 (aa 34-116) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700028D05Rik; CCDC19; CFAP45; cilia and flagella associated protein 45; cilia- and flagella-associated protein 45; coiled-coil domain containing 19; Coiled-coil domain-containing protein 19; coiled-coil domain-containing protein 19, mitochondrial; nasopharyngeal epithelium specific protein 1; nasopharyngeal epithelium specific protein 1 (NESG1); nasopharyngeal epithelium-specific protein 1; NESG1; protein CFAP45, mitochondrial; Unknown (protein for MGC:134208)
Common Name CCDC19
Gene Symbol CFAP45
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less