missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94351

Invitrogen™ Human C1orf77 (aa 179-248) Control Fragment Recombinant Protein

Catalog No. RP94351
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94351 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94351 Supplier Invitrogen™ Supplier No. RP94351
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55929 (PA5-55929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHTOP is a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

Accession Number Q9Y3Y2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26097
Name Human C1orf77 (aa 179-248) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2500003M10Rik; C1orf77; C3H1orf77; chromatin target of PRMT1; chromatin target of PRMT1 protein; Chtop; DKFZP547E1010; FL-SRAG; FOP; Friend of Prmt1; Friend of PRMT1 protein; HT031; hypothetical protein LOC616638; MNCb-1706; PP7704; RP1-178F15.2; similar to DKFZP547E1010 protein; small arginine- and glycine-rich protein; small protein rich in arginine and glycine; Srag; SRAG-3; SRAG-5
Common Name C1orf77
Gene Symbol CHTOP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less