missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90828

Invitrogen™ Human BMP1 (aa 37-146) Control Fragment Recombinant Protein

Catalog No. RP90828
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90828 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90828 Supplier Invitrogen™ Supplier No. RP90828
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82506 (PA5-82506. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region.

Specifications

Accession Number P13497
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 649
Name Human BMP1 (aa 37-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BMP; Bmp1; BMP-1; Bone morphogenetic protein; Bone morphogenetic protein 1; FLJ44432; mammalian tolloid protein; mTld; OI13; PCOLC; Pcp; PCP2; pCP-2; procollagen C-endopeptidase; procollagen C-proteinase; procollagen C-proteinase 3; TLD
Common Name BMP1
Gene Symbol BMP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less