missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108483

Invitrogen™ Human ARR3 (aa 73-125) Control Fragment Recombinant Protein

Catalog No. RP108483
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108483 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108483 Supplier Invitrogen™ Supplier No. RP108483
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84584 (PA5-84584. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins.

Specifications

Accession Number P36575
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 407
Name Human ARR3 (aa 73-125) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARR3; Arr4; arrestin 3; arrestin 3 retinal (X-arrestin); arrestin 3, retinal; arrestin 3, retinal (X-arrestin); arrestin 4; Arrestin C; ArrestinC; arrestin-C; ARRX; Car; Carfl; cArr; C-arrestin; Cone arrestin; retinal cone arrestin-3; X-arrestin
Common Name ARR3
Gene Symbol Arr3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less