missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Aquaporin 8 (aa 4-34) Control Fragment Recombinant Protein

Catalog No. RP98366
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98366 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98366 Supplier Invitrogen™ Supplier No. RP98366
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61197 (PA5-61197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin-8 is a protein that in humans is encoded by the AQP8 gene. Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. Forms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea. Expressed only in pancreas and colon.

Specifications

Accession Number O94778
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 343
Name Human Aquaporin 8 (aa 4-34) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI255744; AQP8; AQP-8; aquaporin 8; Aquaporin8; aquaporin-8; membrane water channel; MGC93492; water channel
Common Name Aquaporin 8
Gene Symbol Aqp8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EIAMCEPEFGNDKAREPSVGGRWRVSWYERF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less