missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109880

Invitrogen™ Human AQP11 (aa 132-165) Control Fragment Recombinant Protein

Catalog No. RP109880
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109880 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109880 Supplier Invitrogen™ Supplier No. RP109880
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145163 (PA5-145163. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aqp11 encodes aquaporins (AQPs) that are integral membrane proteins that facilitate the transport of water across biological membranes along an osmotic gradient. There have been 13 AQP isoforms (AQP0-AQP12) identified in humans and rodents to date. Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.

Specifications

Accession Number Q8NBQ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 282679
Name Human AQP11 (aa 132-165) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700015P13Rik; AI648923; AQP11; AQP-11; AQPX1; aquaporin 11; aquaporin-11; CG12251 gene product; PSEC0027; sjds
Common Name AQP11
Gene Symbol AQP11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RYCTSALWSLGLTQYHVSERSFACKNPIRVDLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less