missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP95118

Invitrogen™ Human Annexin A11 (aa 147-221) Control Fragment Recombinant Protein

Catalog No. RP95118
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95118 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95118 Supplier Invitrogen™ Supplier No. RP95118
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82983 (PA5-82983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Transcript variants encoding the same isoform have been identified.

Specifications

Accession Number P50995
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 311
Name Human Annexin A11 (aa 147-221) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 56 kDa autoantigen; A830099O17Rik; annexin; annexin A11; Annexin A11 (Annexin XI) (Calcyclin-associated annexin 50) (CAP-50); annexin XI; Annexin-11; AN x 11; Anxa11; autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50; Calcyclin-associated annexin-50; CAP50; CAP-50; OTTHUMP00000019957; OTTHUMP00000019958; RP11-369J21
Common Name Annexin A11
Gene Symbol ANXA11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less