missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102345

Invitrogen™ Human AMPK beta-2 (aa 1-96) Control Fragment Recombinant Protein

Catalog No. RP102345
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102345 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102345 Supplier Invitrogen™ Supplier No. RP102345
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60678 (PA5-60678. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AMPK Beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Specifications

Accession Number O43741
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5565
Name Human AMPK beta-2 (aa 1-96) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730553K21Rik; 5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase, beta-2 subunit; AMP-activated protein kinase beta 2 non-catalytic subunit; AMP-activated protein kinase beta-2 regulatory subunit; AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2; AMPKbeta2; AW049591; BB124140; Prkab2; protein kinase AMP-activated non-catalytic subunit beta 2; protein kinase, AMP-activated, beta 2 non-catalytic subunit
Common Name AMPK beta-2
Gene Symbol Prkab2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less