missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ALX4 Control Fragment Recombinant Protein

Catalog No. RP105685
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105685 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105685 Supplier Invitrogen™ Supplier No. RP105685
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64883 (PA5-64883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a paired-like homeodomain transcription factor expressed in the mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations in this gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification of the parietal bones. Mutations in this gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role for this gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containing this gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse, this gene has been shown to use dual translation initiation sites located 16 codons apart.

Specifications

Accession Number Q9H161
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60529
Name Human ALX4 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ALX homeobox 4; ALX4; ALX-4; aristaless 4; Aristaless-like 4; aristaless-like homeobox 4; CRS5; FND2; Homeobox protein aristaless-like 4; homeodomain transcription factor ALX4; KIAA1788; lst; Strong's luxoid
Common Name ALX4
Gene Symbol ALX4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQEGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less