missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108168

Invitrogen™ Human ADPRHL1 (aa 21-88) Control Fragment Recombinant Protein

Catalog No. RP108168
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108168 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108168 Supplier Invitrogen™ Supplier No. RP108168
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL1, reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]). [supplied by OMIM].

Specifications

Accession Number Q8NDY3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 113622
Name Human ADPRHL1 (aa 21-88) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [Protein ADP-ribosylarginine] hydrolase-like protein 1; ADPRHL1; ADP-ribosylarginine hydrolase like 1; ADP-ribosyl-hydrolase; ADP-ribosylhydrolase 2; ADP-ribosylhydrolase like 1; Arh2; D330008N11Rik
Common Name ADPRHL1
Gene Symbol ADPRHL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less