missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP93050

Invitrogen™ Human Adenylate Kinase 8 (aa 141-248) Control Fragment Recombinant Protein

Catalog No. RP93050
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93050 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93050 Supplier Invitrogen™ Supplier No. RP93050
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54918 (PA5-54918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enables AMP binding activity and nucleobase-containing compound kinase activity. Involved in nucleoside diphosphate phosphorylation and nucleoside triphosphate biosynthetic process. Located in 9+2 motile cilium.

Specifications

Accession Number Q96MA6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 158067
Name Human Adenylate Kinase 8 (aa 141-248) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190002A17Rik; Adenylate kinase 8; Adenylate kinase isoenzyme 4, mitochondrial (ATP-AMP transphosphorylase); AK 8; AK8; ATP-AMP transphosphorylase 8; C9orf98; DDX31; HypB, AroK, ADK and rho factor domain containing protein RGD1303144; putative adenylate kinase-like protein C9orf98; putative adenylate kinase-like protein C9orf98 homolog; RGD1303144; RP11-143F18.1
Common Name Adenylate Kinase 8
Gene Symbol Ak8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less