missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAMTS7 Control Fragment Recombinant Protein

Catalog No. RP106192
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106192 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106192 Supplier Invitrogen™ Supplier No. RP106192
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65516 (PA5-65516. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin type-1 modules) is a family of zinc-dependent proteases that are implicated in a variety of normal and pathological conditions, including arthritis and cancer. ADAMTS protein family members contain an N-terminal propeptide domain, a metalloproteinase domain, a disintegrin-like domain and a C-terminus that contains a varying number of thrombospondin type-1 (TSP-1) motifs. ADAMTS genes are primarily expressed in fetal tissues, including lung, kidney and liver. ADAMTS-7 (ADAM metallopeptidase with thrombospondin type 1 motif, 7), also known as COMPase, is a 1,686 amino acid protein that exists as two alternatively spliced isoforms. Encoded by a gene that maps to human chromosome 15q25.1, ADAMTS-7 contains eight TSP-1 motifs and binds one zinc ion per subunit. ADAMTS-7 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ADAMTS-7 is also located in meniscus, bone, tendon, cartilage, synovium, fat and ligaments, and is up-regulated in articular cartilage and synovium in arthritis patients. ADAMTS-7 functions as a metalloprotease and may play a role in the degradation of COMP. ADAMTS-7 is pH dependent, with optimum pH between 7.5 and 9.5.

Specifications

Accession Number Q9UKP4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11173
Name Human ADAMTS7 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 7; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 7; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 7; ADAM metallopeptidase with thrombospondin type 1 motif, 7; ADAMs; ADAM-TS 7; ADAMTS7; ADAM-TS7; ADAMTS-7; ADAMTS7B; COMPase; metalloendopeptidases; metalloprotease
Common Name ADAMTS7
Gene Symbol ADAMTS7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less