missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ACCSL (aa 87-175) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109078
Description
Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139872 (PA5-139872. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ACCSL gene ontology annotations related to this gene include biosynthetic process.Specifications
| Q4AC99 | |
| Blocking Assay, Control | |
| 390110 | |
| 100 μL | |
| 1-aminocyclopropane-1-carboxylate synthase (inactive)-like; 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like; 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like; 1-aminocyclopropane-1-carboxylate synthase-like protein 2; ACC synthase-like protein 2; ACCSL; Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 | |
| ACCSL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ACCSL (aa 87-175) Control Fragment | |
| RUO | |
| ACCSL | |
| Unconjugated | |
| Recombinant | |
| ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |