missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP247394PE

R&D Systems™ GVQW3 Recombinant Protein Antigen

Catalog No. NBP247394PE
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP247394PE 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP247394PE Supplier R&D Systems™ Supplier No. NBP247394PEP

Please call Customer Service at 1-800-234-7437 or send an email to help@thermofisher.com for assistance.

Description

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RP11 - 111M22.2. The GVQW3 Recombinant Protein Antigen is derived from E. coli. The GVQW3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-47394. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Gene ID (Entrez) 100506127
Species Human
Product Line Novus
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias FLJ37770
Gene Symbol RP11-111M22.2
Label Type Unlabeled
Molecular Weight (g/mol) 27kDa
Product Type LOC100506127
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47394. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen RYLEQRISIKFCVKLNKSASETHHLLKEAYGDEVMSRARVFDWHKRFKEGREDVRDDARSGRPVTHRTDDNIQKVKDLVCS
Show More Show Less

For Research Use Only