missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

$527.00 - $1,099.00

Specifications

Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Host Species Human, Mouse
Inhibitors TLR2, TLR4
Molecular Weight 3701.4
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP229331 Novus Biologicals™
NBP229331
2mg Each for $527.00
NBP2293315 Novus Biologicals™
NBP2293315MG
5mg Each for $1,099.00
Specifications Description & Specifications

Specifications

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
TLR2, TLR4
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibition of TIRAP binding to TLR2 or TLR4
Human, Mouse
3701.4
Lyophilized
TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.