Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

$483.00 - $1,063.00

Specifications

Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors TLR2, TLR4
Molecular Weight 3701.4
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Quantity Price Quantity    

NBP229331

 
novus biologicals™
NBP2-29331
2mg Each for $483.00

NBP2293315

 
novus biologicals™
NBP2-29331-5MG
5mg Each for $1,063.00
Description & Specifications

Specifications

Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Inhibitors TLR2, TLR4
Molecular Weight 3701.4
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
For Use With (Application) Inhibition of TIRAP binding to TLR2 or TLR4
Includes TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.