Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

Manufacturer: novus biologicals™  NBP2-29331-5MG

 View all options for this product

Catalog No. NBP2293315


Description & Specifications


Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Format Lyophilized
Inhibitors TLR2, TLR4
Molecular Weight 3701.4
Includes TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Quantity 5mg
For Use With (Application) Inhibition of TIRAP binding to TLR2 or TLR4
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.