Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set


For use in research applications

Manufacturer: novus biologicals™  NBP2293315MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP2293315

  • / Each
 

Description & Specifications

Specifications

Quantity 5mg
Molecular Weight 3701.4
Host Species Human, Mouse
Inhibitors TLR2, TLR4
For Use With (Application) Inhibition of TIRAP binding to TLR2 or TLR4
Includes TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized