missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

For use in research applications

Manufacturer:  Novus Biologicals™ NBP2293315MG

 View more versions of this product

Catalog No. NBP2293315



For Research Use Only

Specifications Description & Specifications


Human, Mouse
Inhibition of TIRAP binding to TLR2 or TLR4
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.