Please login to your online account to display your discounted pricing

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set


For use in research applications

Manufacturer: novus biologicals™  NBP229331

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP229331

  • / Each
 

Description & Specifications

Specifications

Host Species Human, Mouse
Includes TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
For Use With (Application) Inhibition of TIRAP binding to TLR2 or TLR4
Inhibitors TLR2, TLR4
Molecular Weight 3701.4
Quantity 2mg
Format Lyophilized
Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.