Please login to your online account to display your discounted pricing

Thermo Scientific™ Lab Vision™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody

Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

$241.57 - $1,153.92


Antigen pS2/pNR-2 Estrogen-Regulated Protein Ab-1
Clone pS2.1
Applications Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unlabeled
View More Specs
Catalog Number Mfr. No. Concentration Quantity Price Quantity    


thermo scientific™ lab vision™
200μg/mL 1mL Each for $1,066.41


thermo scientific™ lab vision™
200μg/mL 100µL Each for $241.57


thermo scientific™ lab vision™
200μg/mL 500µL Each for $703.90


thermo scientific™ lab vision™
1mg/mL 100µL Each for $790.08


thermo scientific™ lab vision™
1mg/mL 200µL Each for $1,153.92
Description & Specifications


Antigen pS2/pNR-2 Estrogen-Regulated Protein Ab-1
Clone pS2.1
Applications Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unlabeled
Cross Reactivity Human
Format Concentrated
Host Species Mouse
Regulatory Status RUO
Research Discipline Cancer and Tumor Biology
Type Primary
Immunogen A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
Isotype IgG1

Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors.

Host Species: Mouse

Clone: pS2.1

Isotype: IgG1

Species Reactivity: Human. Others not known.

Epitope: aa 54-84

Immunogen: A synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein

Molecular Weight: 6.5kDa

Cellular Localization: Cytoplasmic Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Recommended for:

  • Immunohistochemistry


USA: RUO; Int'l: RUO