missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Thermo Scientific™ Lab Vision™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody

Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

Manufacturer:  Thermo Scientific™ Lab Vision™ MS111P1ABX

 View more versions of this product

Catalog No. MS111P1ABX




Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors.

Host Species: Mouse

Clone: pS2.1

Isotype: IgG1

Species Reactivity: Human. Others not known.

Epitope: aa 54-84

Immunogen: A synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein

Molecular Weight: 6.5kDa

Cellular Localization: Cytoplasmic Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Recommended for:

  • Immunohistochemistry


USA: RUO; Int'l: RUO

Description & Specifications


pS2/pNR-2 Estrogen-Regulated Protein Ab-1
Immunohistochemistry (Paraffin)
A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
Cancer and Tumor Biology