Please login to your online account to display your discounted pricing

Thermo Scientific™ Lab Vision™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody


Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

Manufacturer: thermo scientific™ lab vision™  MS111P1ABX

 View more versions of this product

Catalog No. MS111P1ABX

  • / Each
 

Description & Specifications

Specifications

Antigen pS2/pNR-2 Estrogen-Regulated Protein Ab-1
Applications Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone pS2.1
Concentration 1mg/mL
Conjugate Unlabeled
Cross Reactivity Human
Format Concentrated
Host Species Murine
Immunogen A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein
Isotype IgG1
Quantity 100μL
Regulatory Status RUO
Research Discipline Cancer and Tumor Biology
Type Primary
Monoclonal or Polyclonal Monoclonal
Target Species Human

Provide accurate, reproducible results with the Thermo Scientific™ pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody.

pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors.

Host Species: Mouse

Clone: pS2.1

Isotype: IgG1

Species Reactivity: Human. Others not known.

Epitope: aa 54-84

Immunogen: A synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein

Molecular Weight: 6.5kDa

Cellular Localization: Cytoplasmic Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.

Recommended for:

  • Immunohistochemistry

Note:

USA: RUO; Int'l: RUO