missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DOG-1.1, Azide Free, Novus Biologicals™

$384.00 - $527.00

Specifications

Antigen DOG1/TMEM16A
Clone DOG-1.1
Concentration 1mg/mL
Immunogen A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP23460602 Novus Biologicals Canada
NBP23460602MG
0.2mg Each for $527.00
NBP23460601 Novus Biologicals Canada
NBP23460601MG
0.1mg Each for $384.00
Specifications Description & Specifications

Specifications

DOG1/TMEM16A
1mg/mL
Q5XXA6
10mM PBS. Does not contain BSA. Azide Free.
Primary
Murine
Unlabeled
Purified
DOG-1.1
A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
55107
Monoclonal
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG1, κ
Purified
ELISA,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot