Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460602MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460602

  • / Each
 

Description & Specifications

Specifications

Antigen DOG1/TMEM16A
Regulatory Status RUO
Gene Accession No. Q5XXA6
Applications ELISA
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Conjugate Unlabeled
Quantity 0.2mg
Isotype IgG1, κ
Host Species Mouse
Cross Reactivity Human
Reconstitution Protein A purified
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Immunogen A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Gene ID (Entrez) 55107
Purification Method Purified
Concentration 1mg/mL
Format Purified
Clone DOG-1.1