Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460601MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460601

  • / Each
 

Description & Specifications

Specifications

Antigen DOG1/TMEM16A
Applications ELISA
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Clone DOG-1.1
Concentration 1mg/mL
Conjugate Unlabeled
Cross Reactivity Human
Format Purified
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Gene Accession No. Q5XXA6
Host Species Mouse
Immunogen A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Isotype IgG1, κ
Purification Method Purified
Quantity 0.1mg
Regulatory Status RUO
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene ID (Entrez) 55107
Reconstitution Protein A purified