Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460601MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460601

  • / Each
 

Description & Specifications

Specifications

Applications ELISA
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Antigen DOG1/TMEM16A
Format Purified
Gene Accession No. Q5XXA6
Host Species Mouse
Immunogen A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Isotype IgG1, κ
Quantity 0.1mg
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene ID (Entrez) 55107
Conjugate Unlabeled
Cross Reactivity Human
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Purification Method Purified
Regulatory Status RUO
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Reconstitution Protein A purified
Clone DOG-1.1
Concentration 1mg/mL