Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Novus Biologicals™

$139.00 - $321.00

Specifications

Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Concentration 0.2mg/mL
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Quantity Price Quantity    

NBP23428501

 
novus biologicals canada
NBP23428501ML
0.1mL Each for $139.00

NBP23428505

 
novus biologicals canada
NBP23428505ML
0.5mL Each for $321.00
Description & Specifications

Specifications

Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Concentration 0.2mg/mL
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
Gene ID (Entrez) 55107
Formulation PBS with 0.05% BSA.
Monoclonal or Polyclonal Monoclonal
Primary or Secondary Primary
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Host Species Mouse
Cross Reactivity Human
Isotype IgG1, κ
Conjugate Unlabeled
Format Purified
Purification Method Purified
Applications Flow Cytometry
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting