Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™

$375.00 - $515.00

Specifications

Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Concentration 1mg/mL
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Quantity Price Quantity    

NBP23460401

 
novus biologicals canada
NBP23460401MG
0.1mg Each for $375.00

NBP23460402

 
novus biologicals canada
NBP23460402MG
0.2mg Each for $515.00
Description & Specifications

Specifications

Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Concentration 1mg/mL
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
Gene ID (Entrez) 55107
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Monoclonal or Polyclonal Monoclonal
Primary or Secondary Primary
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Host Species Mouse
Cross Reactivity Human
Isotype IgG1, κ
Conjugate Unlabeled
Format Purified
Purification Method Purified
Applications Flow Cytometry
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting