missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™

$527.00 - $527.00

Specifications

Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Concentration 1mg/mL
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Gene Accession No. Q5XXA6
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP23460402 Novus Biologicals Canada
NBP23460402MG
0.2mg Each for $527.00
Specifications Description & Specifications

Specifications

DOG1/TMEM16A
1mg/mL
Q5XXA6
10mM PBS. Does not contain BSA. Azide Free.
Primary
Murine
Unlabeled
Purified
DG1/447 + DOG-1.1
Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
55107
Monoclonal
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG1, κ
Purified
Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot