Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460402MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460402

  • / Each
 

Description & Specifications

Specifications

Cross Reactivity Human
Host Species Mouse
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Applications Flow Cytometry
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Antigen DOG1/TMEM16A
Clone DG1/447 + DOG-1.1
Gene ID (Entrez) 55107
Quantity 0.2mg
Monoclonal or Polyclonal Monoclonal
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Reconstitution Protein A purified
Isotype IgG1, κ
Format Purified
Conjugate Unlabeled
Regulatory Status RUO
Concentration 1mg/mL
Primary or Secondary Primary
Gene Accession No. Q5XXA6
Purification Method Purified
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.