missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP23460402MG

 View more versions of this product

Catalog No. NBP23460402


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

DOG1/TMEM16A
DG1/447 + DOG-1.1
Unlabeled
10mM PBS. Does not contain BSA. Azide Free.
Murine
IgG1, κ
0.2mg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Monoclonal
Protein A purified
Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
1mg/mL
Purified
Q5XXA6
Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Purified
RUO
Primary
55107
Human