Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460401MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460401

  • / Each
 

Description & Specifications

Specifications

Antigen DOG1/TMEM16A
Format Purified
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Gene Accession No. Q5XXA6
Host Species Mouse
Applications Flow Cytometry
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Isotype IgG1, κ
Purification Method Purified
Quantity 0.1mg
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Primary or Secondary Primary
Monoclonal or Polyclonal Monoclonal
Gene ID (Entrez) 55107
Reconstitution Protein A purified
Clone DG1/447 + DOG-1.1
Concentration 1mg/mL
Conjugate Unlabeled
Cross Reactivity Human
Regulatory Status RUO