Please login to your online account to display your discounted pricing

Mouse anti-DOG1/TMEM16A, Clone: DG1/447 + DOG-1.1, Azide Free, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP23460401MG

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP23460401

  • / Each
 

Description & Specifications

Specifications

Cross Reactivity Human
Formulation 10mM PBS. Does not contain BSA. Azide Free.
Primary or Secondary Primary
Conjugate Unlabeled
Isotype IgG1, κ
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Purification Method Purified
Clone DG1/447 + DOG-1.1
Monoclonal or Polyclonal Monoclonal
Applications Flow Cytometry
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry (Frozen)
Applications Immunohistochemistry (Paraffin)
Applications Immunoprecipitation
Applications Western Blotting
Antigen DOG1/TMEM16A
Immunogen Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL)
Quantity 0.1mg
Reconstitution Protein A purified
Format Purified
Gene Accession No. Q5XXA6
Gene ID (Entrez) 55107
Host Species Mouse
Concentration 1mg/mL
Regulatory Status RUO