missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105749

Invitrogen™ Human ZIP11 (aa 222-264) Control Fragment Recombinant Protein

Catalog No. RP105749
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105749 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105749 Supplier Invitrogen™ Supplier No. RP105749
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64987 (PA5-64987. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIP11, also known as Slc39A11, is a member of the broader ZIP family of multi-transmembrane domain metal ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. Members of the ZIP family generally transport metal ions from the cell exterior or lumen of intracellular organelles into the cytoplasm, as opposed to the ZnT (SLC30) family of zinc transporters that serve to reduce intracellular zinc availability by promoting zinc efflux from cells or into intracellular vesicles. At least three isoforms of ZIP11 are known to exist.

Specifications

Accession Number Q8N1S5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 201266
Name Human ZIP11 (aa 222-264) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810074D23Rik; C17orf26; SLC39A11; solute carrier family 39 (metal ion transporter), member 11; solute carrier family 39 member 11; solute carrier family 39, member 11; zinc transporter ZIP11; ZIP11; ZIP-11; Zrt- and Irt-like protein 11
Common Name ZIP11
Gene Symbol SLC39A11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less