missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100519

Invitrogen™ Human Vinculin (aa 173-321) Control Fragment Recombinant Protein

Catalog No. RP100519
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100519 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100519 Supplier Invitrogen™ Supplier No. RP100519
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82003 (PA5-82003. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vinculin (VCL) is a cytoskeletal protein associated with cell-cell and cell-extracellular matrix adherens-type junctions. It functions as one of several interacting proteins involved in anchoring F-actin to the membrane. It has been shown that a sequence of molecular interactions might be involved in the transmembrane assembly of adhesion plaques. In the assembly of adhesion plaques, the beta subunit of integrin binds to talin. Talin binds to vinculin that interacts with alpha-actinin and possibly with itself. Since alpha-actinin binds to and cross-links actin filaments, vinculin represents a key element in the transmembrane linkage of the extracellular matrix to the cytoplasmic microfilament system. Mutations in the gene can result in cardiomyopathy dilated 1W or familial hypertrophic 15.

Specifications

Accession Number P18206
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7414
Name Human Vinculin (aa 173-321) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430097D22; AA571387; AI462105; AW545629; CMD1W; CMH15; epididymis luminal protein 114; HEL114; metavinculin; meta-vinculin; metavinculin {ECO:0000250; MV; MVCL; RP11-178G16.3; UniProtKB:P18206}; unnamed protein product; Vcl; vcl {ECO:0000250; VIN; vinc; vinc 1; VINC1; Vinculin; vinculin {ECO:0000250
Common Name Vinculin
Gene Symbol VCL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less