missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108928

Invitrogen™ Human TSLP Control Fragment Recombinant Protein

Catalog No. RP108928
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108928 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108928 Supplier Invitrogen™ Supplier No. RP108928
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSLP is a 159 amino acid four helix-bundle hemopoietic cytokine that signals through a heterodimeric receptor complex consisting of the human TSLP receptor and the IL-7R alpha-chain. It impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes, enhances the maturation of CD11c (+) dendritic cells, naive CD4 (+), and CD8 (+) T cells into proallergic effectors, and primes dendritic cells to produce large amounts of IL-12 after CD40 ligand stimulation. TSLP influences the regulation of the positive selection of regulatory T cells and maintenance of peripheral CD4 (+) T cell homeostasis. It induces allergic inflammation by directly activating mast cells and may be involved in the pathophysiology of inflammatory arthritis. It is expressed in heart, liver and prostate.

Specifications

Accession Number Q969D9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85480
Name Human TSLP Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Thymic stroma-derived lymphopoietin; thymic stromal lymphopoietin; TSLP
Common Name TSLP
Gene Symbol TSLP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKCLGQSKKEEVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less