missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103572

Invitrogen™ Human SPICE1 (aa 440-513) Control Fragment Recombinant Protein

Catalog No. RP103572
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103572 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103572 Supplier Invitrogen™ Supplier No. RP103572
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64185 (PA5-64185. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator required for centriole duplication, for proper bipolar spindle formation and chromosome congression in mitosis.

Specifications

Accession Number Q8N0Z3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 152185
Name Human SPICE1 (aa 440-513) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CCDC52; coiled-coil domain containing 52; coiled-coil domain-containing protein 52; D16Ertd480e; RGD1310729; SPICE; SPICE1; spindle and centriole associated protein 1; spindle and centriole protein; Spindle and centriole-associated protein; Spindle and centriole-associated protein 1
Common Name SPICE1
Gene Symbol SPICE1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less