missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103208

Invitrogen™ Human SGLT1 (aa 224-261) Control Fragment Recombinant Protein

Catalog No. RP103208
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103208 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103208 Supplier Invitrogen™ Supplier No. RP103208
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84237 (PA5-84237. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucose transporters are integral membrane proteins that mediate the transport of glucose and structurally-related substances across cellular membranes. Two families of glucose transporter have been identified: the facilitated-diffusion glucose transporter family. The SLC5A1 gene encodes a protein that is involved in the active transport of glucose and galactose into eukaryotic and some prokaryotic cells.

Specifications

Accession Number P13866
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6523
Name Human SGLT1 (aa 224-261) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D22S675; High affinity sodium-glucose cotransporter; HSGLT1; MGC93553; Na; Na(+)/glucose cotransporter 1; Na+/glucose cotransporter 1; NAGT; Sglt1; SLC5A1; sodium glucose cotransporter 1; sodium/glucose cotransporter 1; sodium-glucose cotransporter 1; sodium-glucose cotransporter-like 1; solute carrier family 5 (sodium/glucose cotransporter), member 1; solute carrier family 5 member 1; solute carrier family 5, member 1; solute carrier family 5, member alpha 1; Solute carrier family 5, member alpha 1 (Na+/glucose cotransporter)
Common Name SGLT1
Gene Symbol Slc5a1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRAD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less