missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105591

Invitrogen™ Human SGCE (aa 355-436) Control Fragment Recombinant Protein

Catalog No. RP105591
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105591 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105591 Supplier Invitrogen™ Supplier No. RP105591
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67363 (PA5-67363. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the epsilon member of the sarcoglycan family. Sarcoglycans are transmembrane proteins that are components of the dystrophin-glycoprotein complex, which link the actin cytoskeleton to the extracellular matrix. Unlike other family members which are predominantly expressed in striated muscle, the epsilon sarcoglycan is more broadly expressed. Mutations in this gene are associated with myoclonus-dystonia syndrome. This gene is imprinted, with preferential expression from the paternal allele. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number O43556
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8910
Name Human SGCE (aa 355-436) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dystonia 11, myoclonic; DYT11; EMBL:AAO37579.1, ECO:0000312; EMBL:AAO37579.1}; Epsilon sarcoglycan; Epsilon SG; Epsilon-sarcoglycan; epsilon-sarcoglycan {ECO:0000312; epsilon-SG; epsilon-SG {ECO:0000250; ESG; e-SG; RGD:1303201}; sarcoglycan; sarcoglycan epsilon; sarcoglycan, epsilon; SGCE; sgce {ECO:0000312; UniProtKB:O43556}; UNQ433/PRO840
Common Name SGCE
Gene Symbol SGCE
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less