missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104345

Invitrogen™ Human SFTPA1 (aa 97-158) Control Fragment Recombinant Protein

Catalog No. RP104345
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104345 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104345 Supplier Invitrogen™ Supplier No. RP104345
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111159 (PA5-111159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Surfactant protein A is an innate immune system collectin. The gene encoding SP-A map to mouse chromosome 14. Surfactant protein-A, which plays a role in innate host defense in the lung, is also expressed in the Eustachian tube. We report that the frequency of specific surfactant protein-A haplotypes and genotypes differs between children with recurrent otitis media compared with a control population.

Specifications

Accession Number Q8IWL2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 653509
Name Human SFTPA1 (aa 97-158) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; COLEC4; Collectin 4; Collectin-4; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; OTTHUMP00000019928; OTTHUMP00000019929; OTTHUMP00000019930; OTTHUMP00000019931; PSAP; PSP A; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; SFTP1; Sftp-1; Sftpa; SFTPA1; SFTPA1B; Sftpl; SP A; SP A1; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; Surfactant; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6 A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6 A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6 A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
Common Name SFTPA1
Gene Symbol SFTPA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less