missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RPS6KC1 (aa 384-483) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94239
Description
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55333 (PA5-55333. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in transmitting sphingosine-1 phosphate (SPP)-mediated signaling into the cell. Plays a role in the recruitment of PRDX3 to early endosomes.Specifications
| Q96S38 | |
| Blocking Assay, Control | |
| 26750 | |
| 100 μL | |
| 52 kDa ribosomal protein S6 kinase; AA682037; B130003F20Rik; C80612; humS6PKh1; ribosomal protein S6 kinase C1; ribosomal protein S6 kinase delta-1; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 52 kDa, polypeptide 1; ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein; RPK118; Rps6kc1; RSKL1; S6K-delta-1; S6PKh1; SPHK1-binding protein | |
| RPS6KC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RPS6KC1 (aa 384-483) Control Fragment | |
| RUO | |
| RPS6KC1 | |
| Unconjugated | |
| Recombinant | |
| VPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFLNRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |