missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PSMC4 (aa 154-292) Control Fragment Recombinant Protein

Catalog No. RP102167
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102167 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102167 Supplier Invitrogen™ Supplier No. RP102167
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52153 (PA5-52153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with an orphan member of the nuclear hormone receptor superfamily highly expressed in liver, and with gankyrin, a liver oncoprotein. Two transcript variants encoding different isoforms have been identified.

Specifications

Accession Number P43686
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5704
Name Human PSMC4 (aa 154-292) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 S protease regulatory subunit 6 B; 26 S proteasome AAA-ATPase subunit RPT3; 26 S proteasome regulatory subunit 6 B; CAR interacing protein 21; CAR interacting protein 21; CIP21; MB67-interacting protein; MGC13687; MGC23214; MGC8570; MIP224; protease 26 S subunit 6; proteasome (prosome, macropain) 26 S subunit, ATPase, 4; proteasome 26 S ATPase subunit 4; proteasome 26 S subunit ATPase 4; proteasome 26 S subunit, ATPase 4; PSMC4; RPT3; S6; S6 ATPase; Tat-binding protein 7; TBP7; TBP-7
Common Name PSMC4
Gene Symbol PSMC4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less