missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98409

Invitrogen™ Human NOR-1 (aa 377-455) Control Fragment Recombinant Protein

Catalog No. RP98409
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98409 Supplier Invitrogen™ Supplier No. RP98409
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOR-1, a NR4 nerve growth factor-like receptor, has been shown to affect neuronal development, T-cell apoptosis, and cancer development. NOR-1 binds to NBRE (NGFI-B response element) and regulates the pro-opiomelanocortin (POMC) gene. NOR-1 is induced rapidly but transiently by a variety of stimuli. Downregulation of NOR-1 and other NGFI-B family members is correlated with drug addiction-prone behavior of Lewis rats. Three human protein isoforms have been documented: NOR-1, NOR-1beta, and NOR-1 3' variant.

Specifications

Accession Number Q92570
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8013
Name Human NOR-1 (aa 377-455) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI573420; CHN; chondrosarcoma, extraskeletal myxoid, fused to EWS; CSMF; MINOR; mitogen-induced nuclear orphan receptor; Neuron-derived orphan receptor 1; neuron-derived orphan receptor 1/2; Nor1; NOR-1; NOR-2; Nr4a3; Nuclear hormone receptor NOR-1; nuclear hormone receptor NOR-1/NOR-2; Nuclear receptor subfamily 4 group A member 3; nuclear receptor subfamily 4, group A, member 3; Orphan nuclear receptor TEC; TEC; TEC receptor; Translocated in extraskeletal chondrosarcoma
Common Name NOR-1
Gene Symbol NR4A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less