missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104268

Invitrogen™ Human NEK5 (aa 451-524) Control Fragment Recombinant Protein

Catalog No. RP104268
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104268 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104268 Supplier Invitrogen™ Supplier No. RP104268
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59551 (PA5-59551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEK5 gene ontology (GO) annotations include positive regulation of cysteine-type endopeptidase activity; positive regulation of striated muscle cell differentiation.

Specifications

Accession Number Q6P3R8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 341676
Name Human NEK5 (aa 451-524) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6530411J22; BB049667; Nek5; Never in mitosis A-related kinase 5; NIMA (never in mitosis gene a)-related expressed kinase 5; NIMA (never in mitosis gene a)-related kinase 5; NIMA related kinase 5; NIMA-related kinase 5; nimA-related protein kinase 5; Serine/threonine-protein kinase Nek5
Common Name NEK5
Gene Symbol NEK5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less