missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MPLKIP (aa 129-179) Control Fragment Recombinant Protein

Catalog No. RP101854
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101854 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101854 Supplier Invitrogen™ Supplier No. RP101854
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in maintenance of cell cycle integrity by regulating mitosis or cytokinesis.

Specifications

Accession Number Q8TAP9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 136647
Name Human MPLKIP (aa 129-179) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ABHS; C7orf11; M-phase specific PLK1 interacting protein; M-phase-specific PLK1-interacting protein; MPLKIP; ORF20; Russell-Silver syndrome region; TTD non-photosensitive 1 protein; TTD4; TTDN1
Common Name MPLKIP
Gene Symbol MPLKIP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less