missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90794

Invitrogen™ Human MFAP1 (aa 250-387) Control Fragment Recombinant Protein

Catalog No. RP90794
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90794 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90794 Supplier Invitrogen™ Supplier No. RP90794
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139758 (PA5-139758, PA5-59958 (PA5-59958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MFAP1 is a component of the elastin-associated microfibrils. Microfibrils, found either in association with elastin or independently, are an important component of the extracellular matrix of many tissues. MFAP1 is one of a number of proteins demonstrated to be essential for cell division.

Specifications

Accession Number P55081
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4236
Name Human MFAP1 (aa 250-387) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4432409M24Rik; Mfap1; Mfap1a; Mfap1b; microfibril associated protein 1; microfibrillar associated protein 1; microfibrillar-associated protein 1; microfibrillar-associated protein 1 A; Microfibrillar-associated protein 1 B; microfibrillar-associated protein 1-like protein; RGD1562232; Spliceosome B complex protein MFAP1; Spliceosome B complex protein MFAP1A; Spliceosome B complex protein MFAP1B
Common Name MFAP1
Gene Symbol MFAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less