missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GCLC (aa 436-536) Control Fragment Recombinant Protein

Catalog No. RP94586
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94586 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94586 Supplier Invitrogen™ Supplier No. RP94586
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.

Specifications

Accession Number P48506
Concentration 0.8 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2729
Name Human GCLC (aa 436-536) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias cb1049; D9Wsu168e; EGK_15023; fe36e11; gamma GCS-HS; gamma-ECS; Gamma-glutamylcysteine synthetase; gamma-glutamylcysteine synthetase heavy subunit; GCL; Gclc; GCS; GCS heavy chain; Ggcs-hs; GLCL; GLCLC; GLCL-H; glutamate-cysteine ligase catalytic subunit; Glutamate--cysteine ligase catalytic subunit; glutamate-cysteine ligase, catalytic subunit; Glutamylcysteine gamma synthetase light chain; wu:fe36e11
Common Name GCLC
Gene Symbol Gclc
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less