missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107147

Invitrogen™ Human FAM222B (aa 493-561) Control Fragment Recombinant Protein

Catalog No. RP107147
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107147 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107147 Supplier Invitrogen™ Supplier No. RP107147
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66474 (PA5-66474. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM222B is a protein coding gene.

Specifications

Accession Number Q8WU58
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55731
Name Human FAM222B (aa 493-561) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630020I17Rik; C17orf63; FAM222B; family with sequence similarity 222 member B; family with sequence similarity 222, member B; protein FAM222B; uncharacterized protein C17orf63; uncharacterized protein C17orf63 homolog
Common Name FAM222B
Gene Symbol FAM222B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less