missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107145

Invitrogen™ Human ECE2 Control Fragment Recombinant Protein

Catalog No. RP107145
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107145 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107145 Supplier Invitrogen™ Supplier No. RP107145
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66470 (PA5-66470. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Converts big endothelin-1 to endothelin-1. Also involved in the processing of various neuroendocrine peptides, including neurotensin, angiotensin I, substance P, proenkephalin-derived peptides, and prodynorphin-derived peptides. May limit beta-amyloid peptide accumulation in brain. May also have methyltransferase activity.

Specifications

Accession Number P0DPD6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9718
Name Human ECE2 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810009K13Rik; 6330509A19Rik; 9630025D12Rik; BB127715; Ece2; ECE-2; ECE-2 A-1; ECE-2 A-2; ECE-2 b-1; ECE-2 b-2; EEF1A lysine methyltransferase 4; EEF1AKMT4; EEF1AKMT4-ECE2; EEF1AKMT4-ECE2 readthrough transcript protein; endothelin converting enzyme 2; endothelin converting enzyme-2; endothelin-converting enzyme 2; Endothelin-converting enzyme 2 region; endothelin-converting enzyme 2 A-1; endothelin-converting enzyme 2 A-2; endothelin-converting enzyme 2 b-1; endothelin-converting enzyme 2 b-2; KIAA0604; Methyltransferase-like region; UNQ403/PRO740
Common Name ECE2
Gene Symbol Ece2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARYAHVPQLRWETMDVRKLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less