missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102164

Invitrogen™ Human EB1 (aa 137-258) Control Fragment Recombinant Protein

Catalog No. RP102164
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102164 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102164 Supplier Invitrogen™ Supplier No. RP102164
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82107 (PA5-82107. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. The MAPRE genes encode the EB1 family proteins. The human MAPRE genes MAPRE1, MAPRE2, and MAPRE3 code for EB1, RP1, and EBF3 proteins, respectively. EB1 family members appear to be expressed ubiquitously. The EB1 (MAPRE1) gene, at 20q11. 2, is fused to MLL in an adult patient with pro-B acute lymphoblastic leukemia. EB1 is a microtubule-associated protein that interacts with the colorectal adenomatous polyposis coli tumor-suppressor protein and plays important roles in regulating microtubule dynamics, cell polarity, and chromosome stability.

Specifications

Accession Number Q15691
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22919
Name Human EB1 (aa 137-258) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5530600P05Rik; adenomatosis polyposis coli binding protein Eb1; adenomatous polyposis coli-binding protein EB1; AI462499; AI504412; APC-binding protein EB1; AW260097; BIM1p; D2Ertd459e; Eb1; end-binding protein 1; Mapre1; MGC117374; MGC129946; microtubule associated protein RP/EB family member 1; Microtubule-associated protein RP/EB family member 1; microtubule-associated protein RP/EB family member 1-like protein; microtubule-associated protein, RP/EB family, member 1
Common Name EB1
Gene Symbol Mapre1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less